PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G335800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 618aa    MW: 64005 Da    PI: 6.1253
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G335800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS250.94.9e-7730661649374
                GRAS  49 LaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegp 139
                         La rla   s + ++ +p  +++++++ +l a+k+fsevsP+l+f+hlt+ qa+l+++ g+ r+H++Dfdi++G QW++L+q+La+R  ++
  Sevir.9G335800.1.p 306 LALRLAL--SPTGETPAPAVATPYDVVLKLGAYKAFSEVSPVLQFAHLTCVQAVLDELGGAGRIHVLDFDIGMGEQWASLMQELAQR-CPA 393
                         5555655..5677777788888899*************************************************************9.788 PP

                GRAS 140 pslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLk 229
                         ++l++T+++s++s++  el+ ++e+L+ fA+elgv ++f ++   ++++l++ eL   + g+a+aV+l +   ++         + +++L+
  Sevir.9G335800.1.p 394 ATLKVTALVSSASHHPLELQLIHENLSGFAAELGVFLQFAPF---NIDTLDPAELVAITgGDAVAVHLPVGSAHVA--------AMPAILR 473
                         9****************************************9...9999*9999966666***********99998........4566*** PP

                GRAS 230 lvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerle 320
                         lvk+l +kvvv v++ +d+++ +F++++++al+ +++l++s++a   ++ ++ +k+Er+l+++ +++ v +++++  +  +    Wr  + 
  Sevir.9G335800.1.p 474 LVKRLGAKVVVSVDHGCDRTELPFAAHLFQALQSCVSLLESVDAA-RPDGDAVAKIERFLVQPGVEQRVVARHRA-AALDKPPLPWRTVFA 562
                         ******************************************999.45668999**************9999998.778888999****** PP

                GRAS 321 eaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         +aGF pv+ s++a++qa++ll++++  g+rve++ g+l+l+W++ +LvsvSaWr
  Sevir.9G335800.1.p 563 SAGFVPVQASTFAESQAEALLKRMALMGFRVEKRGGALCLYWQRGELVSVSAWR 616
                         *****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098531.612239596IPR005202Transcription factor GRAS
PfamPF035141.7E-74306616IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
MPFAGSAREG HAGTLLLLQQ QQQQQQQGLA AGKFSVAAGL WEPTSVLDHR HSPSPSPPNS  60
ASTLSSPLGA ATAGVAALAG ANAKNVSPPP QAAAWPGGAP GEDAAAGGRE EWQLTPLDMG  120
LGAGEGWDAA GAVLSDGAAP PGLAPDHTFL RWIIGGEDAS AAMGAVMDPP VLELDHAPSM  180
MSPAFGPNMP FGPGMEDTKA APFGHASNLL IHHHQHHPQP HAAFFGSHPS FDAAAPPPKR  240
HHPMSGAPAP KLPSFPGPAA PAGGFVPAMK PKAEAANDEA AAAVDQLLEA AKLADAGDAF  300
GAREILALRL ALSPTGETPA PAVATPYDVV LKLGAYKAFS EVSPVLQFAH LTCVQAVLDE  360
LGGAGRIHVL DFDIGMGEQW ASLMQELAQR CPAATLKVTA LVSSASHHPL ELQLIHENLS  420
GFAAELGVFL QFAPFNIDTL DPAELVAITG GDAVAVHLPV GSAHVAAMPA ILRLVKRLGA  480
KVVVSVDHGC DRTELPFAAH LFQALQSCVS LLESVDAARP DGDAVAKIER FLVQPGVEQR  540
VVARHRAAAL DKPPLPWRTV FASAGFVPVQ ASTFAESQAE ALLKRMALMG FRVEKRGGAL  600
CLYWQRGELV SVSAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2428161614375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0425220.0BT042522.1 Zea mays full-length cDNA clone ZM_BFb0316K19 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983724.10.0PREDICTED: scarecrow-like protein 6 isoform X2
TrEMBLK4AJM70.0K4AJM7_SETIT; Uncharacterized protein
STRINGSi039098m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67232954
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.17e-83GRAS family protein